DPCstruct | MC15903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 186 ± 27 aa |
| Standard deviation of domain lengths | 26.73 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 22.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07426 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P3RG31 | 7-181 | VQRLQARVEELERWVYGPDGSRGSRKVADGLVKVQVALGNIASKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQF… |
| A0A6J1SH60 | 2-187 | DPLNLLDDRISELERKVLGTRGSAAASLRGDTEKLSVLEALSHANQLLNSALSGREKALAVMQRISELNRYMDPTFEDSTMTCEAKL… |
| D3BAQ0 | 9-244 | None |
| A0A482WU92 | 1-177 | None |
| A0A4P9Y583 | 59-267 | None |
| A0A7E4S7P3 | 10-184 | None |
| S9X2T7 | 1-156 | None |
| A0A1Y1Y0V1 | 1-196 | None |
| A0A0V1D976 | 1-177 | None |
| A0A1C7NHX0 | 1-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.