DPCstruct | MC15902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 177 ± 22 aa |
| Standard deviation of domain lengths | 22.06 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672RW76 | 205-375 | EDLLEEVQRDYEFNLRKSIVDYILLDPAERERLSVSAVPRPFPSRVIRAPVPWSESYREAHSWQTENLCTVNPMMLHVQDLWMSSFT… |
| A0A6J1SA74 | 1-201 | MNTLRFVIFDYIMLDPAERDRLNIKTYPKPFFRVCIRAPVPWHQTVITNKQMIEHHLFIVNPVLVALRDLWLDEYNDMLIVPVSQLE… |
| A0A4W4DR62 | 203-338 | None |
| A0A401SPD5 | 16-230 | None |
| A0A1S8WPZ4 | 28-203 | None |
| A0A1A8BYC0 | 215-385 | None |
| A0A4Z2CJW7 | 27-192 | None |
| A0A1A9YCJ1 | 34-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.