DPCstruct | MC15901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 105 ± 9 aa |
| Standard deviation of domain lengths | 9.21 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K0UB07 | 1-102 | MASKVERIVARLQEKIADGDFYEAQQQTRVAASRYIKTQNWPAAIDILYSVAQSLLKAAQGGSGGDLCVMMVDVYKQAELKPDATSK… |
| A0A6J1S7X0 | 1-104 | MAARRSGGVQRVLDKLEASVSAGNFYEAHQMYRTLYFRYSMQEKYKELLELLYSGSKLLLQNKQLTSGADLCNLFVDVLQKSSEPVT… |
| A0A139HD42 | 164-264 | None |
| A0A1V9ZYH2 | 8-117 | None |
| C7IWM8 | 7-106 | None |
| A0A3P6RDW0 | 50-164 | None |
| A0A0G0A881 | 241-350 | None |
| A0A7J0EIC1 | 5-116 | None |
| T1JH00 | 701-808 | None |
| A0A1L0BXS4 | 400-505 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.