DPCstruct | MC1590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 128 ± 10 aa |
| Standard deviation of domain lengths | 10.07 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6NJ28 | 1-119 | MDVLTFMSLKQSVINVLLVPEVKGLLGVNVADLKRYESAAQIQEWIRLQLQVDLDSLQLDLTGGRNSSVTQTTVSGTTTSSSSTKAP… |
| A0A3M0KXL9 | 239-359 | GAPAVDLKALSKDDVNMNVTTFVTLRRESLMYLTPREVQGLLGMNLPELARWQDRSPVRDWIQLQRQSELDQLHVGLTGGTQEGYIN… |
| A0A061A6P6 | 27-160 | None |
| A0A3Q3F268 | 757-893 | None |
| A0A7M4FBU9 | 405-523 | None |
| A0A3L8RXJ2 | 225-365 | None |
| A0A3M0LEH1 | 291-431 | None |
| A0A401SHV3 | 239-370 | None |
| A0A444UBF6 | 1085-1199 | None |
| A0A2K6CDW6 | 466-586 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.