DPCstruct | MC159
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 6.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 51.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6SNE1 | 203-283 | SGPGTGKTMLTWFLREKVLGPKITMKTTNEKIITGQFNKELEGKCLLVLEEMSNSKSTDWITFANRLKDFIDSDTLMIEEK |
| A0A2H5TPD2 | 1-65 | MRSLPRCGKNISTDFIGERILGRENFLSTTRLEDVMGRFNAAVRAKKLIILNECDMSGKEWHGAN |
| A0A2I1F714 | 644-723 | None |
| A0A397J6Q9 | 13-92 | None |
| U9UKN8 | 37-124 | None |
| A0A2H5S9V2 | 1-80 | None |
| A0A2H5S2U5 | 316-399 | None |
| A0A2Z6R4L3 | 13-92 | None |
| A0A2N0QHB4 | 49-114 | None |
| A0A2H5SYT2 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.