DPCstruct | MC15899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 158 ± 32 aa |
| Standard deviation of domain lengths | 31.81 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.16 |
| Pfam Score | 99.09 |
| Assigned Pfam label(s) | PF15990- PF03359 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7IP36 | 19-138 | RSVCPRDGRWFLKLLQAETERMEGWCRQMEQDEVENELPDEVLGKIRSAVGSAQLLMSQKFQQFRELCEENLNRNAHPRPVSQDLAG… |
| A0A6J1RZH0 | 6-174 | ASHYRDLLNQECTAITGLCDNWQSVLKDSDSCSAIPDDVCGKIQIAIGQAHLLMRKKFEQFRGLISACETNSSERPVTVQDLQGYWE… |
| A0A0R3QRN3 | 1-147 | None |
| A0A7R9A433 | 336-512 | None |
| A0A821WRN3 | 520-691 | None |
| A0A5N5TL94 | 1-142 | None |
| A0A1I8INH3 | 132-301 | None |
| A0A7N8YPE1 | 272-457 | None |
| A0A4W4FGY7 | 102-271 | None |
| A0A7J7F492 | 144-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.