DPCstruct | MC15897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 266 ± 38 aa |
| Standard deviation of domain lengths | 38.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18484 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A5KSD2 | 27-278 | ELTERLQNDEFYITTDERIPRRCIDGRSPAVGGFHDAAPNSAGGSLTLLVADELIGRHVHVEGESTAADLSRLLKTLKQKGYQVGGH… |
| A4BFQ7 | 3-258 | WLSTDEIIGKVPCTCVDGRTSGLRYSAAGGSLGLLMSILNYAEKKRGRSLTDDEIHDAIHSLAITTSPMYLHTDQHTIELIYARMGL… |
| Q4N8W4 | 70-339 | None |
| A0A352PBJ1 | 19-203 | None |
| A0A1F7AS61 | 33-284 | None |
| A0A7T9EWW2 | 30-326 | None |
| A0A6L9IRV7 | 3-231 | None |
| A0A1F7HZU6 | 13-252 | None |
| C1ECX3 | 38-228 | None |
| A0A0G0BK10 | 15-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.