DPCstruct | MC15896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 351 ± 63 aa |
| Standard deviation of domain lengths | 63.47 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R5L504 | 23-374 | GVFFNMMGPVRYYRYGWFAKRKDIMGGLDQHARHEYFKRFGFDEPFGFDKPFNAGSDMNAAFMRFYEKWYGRKFFIGPMIIHCFVTL… |
| A0A3A8L2F5 | 5-315 | NVLYGPRVDELYGQQDSPLGAHLPLLISTLLITLGWLTVAPPSGLAGASGEGSPIPTMTVTSTSFLGAYFFILQMLFRRYVRSDLGP… |
| A0A538QRB5 | 215-548 | None |
| A0A511T782 | 43-384 | None |
| A0A2D5UEP6 | 2-192 | None |
| A0A1V4YD95 | 119-516 | None |
| A0A358JLV9 | 17-347 | None |
| A0A017SV70 | 171-560 | None |
| A0A2W6WC45 | 1-410 | None |
| A0A4R5UIW4 | 28-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.