DPCstruct | MC15889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 170 ± 27 aa |
| Standard deviation of domain lengths | 27.18 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0TZP5 | 6-168 | DQLDFNFSRPIDFQRNLSLNFVDQILFVIDNEYKKNLIYSKHFKFLILELFFCWTESSNQMLTVSMSKRGYLSESRYNPNKISSYLI… |
| A0A858ST60 | 4-180 | DDDWLFDAAGAIREDLNYSDRLDVHRWTDHKEAIPFINNIYDRYFAGGYRNVTMKNLKVVVLDLFVKWKSDPNLKTSYSRNSNDYQV… |
| A0A1X1YP96 | 9-167 | None |
| A0A7Y9XU72 | 10-212 | None |
| G5ZYV6 | 1-131 | None |
| G5ZX67 | 63-232 | None |
| A3V1X0 | 5-169 | None |
| A0A1V5UPC0 | 6-170 | None |
| A0A503Q6Q9 | 7-148 | None |
| A0A0E3V0C6 | 29-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.