DPCstruct | MC15888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 133 ± 17 aa |
| Standard deviation of domain lengths | 16.77 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 13.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L5KXF0 | 16-142 | GSYAQNFADYFQNKTLRVDYIFTGDATQQAIYLDELSQLPTWAGRQHHLSELPLEGNGQIIVKDLASKQCIYKTSFSSLFQEWLSTD… |
| A0A842X6Q4 | 9-141 | ALAVLILSQISAGEQDYRKAVIMEMTSRQGYVAMDDVRVVYGVAPRVLYDFEDDASLKMVVRTKADDVWWTRIIQDPRHCQIADEEG… |
| A0A3D3GEB6 | 3-152 | None |
| A0A4R5LMT3 | 24-158 | None |
| A0A1J5FNF0 | 50-200 | None |
| A0A0G1VHV0 | 104-225 | None |
| A0A3M1RJ77 | 13-146 | None |
| A0A1G2P105 | 46-185 | None |
| A0A1M3IJ92 | 30-168 | None |
| A0A3R9E7G8 | 22-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.