DPCstruct | MC15887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 82 ± 11 aa |
| Standard deviation of domain lengths | 11.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497SA02 | 483-558 | KIACKENSDCGEIIKKRVCYNNDVYEQTIIPICYNPGTPEAECKFRISGISRGGQLLPPLEDCDPGYCLDGQCVGK |
| A0A7J3LMQ6 | 156-225 | PHAIMCTRNDDCGPNVYSNLPECNGSLVVDQYMYWVCNQPGTIQSSCEFHIEEKIIQDCSPGECVEGLCI |
| A0A5E4JQW9 | 163-228 | None |
| A0A842TS85 | 1-75 | None |
| A0A7K4C074 | 440-529 | None |
| A0A522EI96 | 32-119 | None |
| A0A842WHJ5 | 67-158 | None |
| A0A7J2ICC8 | 6-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.