DPCstruct | MC15878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 174 ± 30 aa |
| Standard deviation of domain lengths | 29.94 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D6DVU6 | 3-102 | WIDALQASPAYAAQKALAARVAPSDAEVRSLLEALAARGGKLSKAALAQRLGMPAMRISGFVNAARRVLNLDQAAVLVLDETAGTVE… |
| A0A350CFD9 | 29-213 | VTDQELVVPIVVLSSSEKLPSGWQEQGVDTPAWWDELEVTTQPAEGSEASLRTAVTPEPGHLFAREEFRRGAEVPAGGEGPVTPEWV… |
| A0A3E0P010 | 992-1191 | None |
| A0A4P7UBN3 | 55-265 | None |
| A0A6N7ZNE5 | 532-710 | None |
| A0A4Q8BMX2 | 550-764 | None |
| A0A7X5UVN3 | 746-892 | None |
| A0A6I4W344 | 628-754 | None |
| A0A011PWR1 | 409-603 | None |
| A0A4D4L0B3 | 601-786 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.