DPCstruct | MC15876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 171 ± 24 aa |
| Standard deviation of domain lengths | 23.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.90 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0023- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8MUV5 | 6-179 | RRQAALLYWQGFSVPQIAAMLQMKRPTVQSWKQRDGWDSVAPISRVEMSLEARLTQLIIKPQKTGGDFKEIDLLGRQIERLARVNRY… |
| A0A250B6V4 | 14-187 | RRQAALLNWQGFSVKQIAEMLKQKAPTVQSWKQREKWDDIAPISRVESSIEARMVQLVLKTKKEGSDYKEIDLLGRQIERLARVRRY… |
| A0A376KK44 | 7-145 | None |
| D4DNQ4 | 105-288 | None |
| A0A2H1QIN2 | 4-176 | None |
| A0A827YBQ8 | 30-224 | None |
| A0A156LL32 | 11-225 | None |
| A0A376PNG1 | 2-128 | None |
| A0A377CZB1 | 7-136 | None |
| A0A433SHA0 | 2-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.