DPCstruct | MC15875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 116 ± 10 aa |
| Standard deviation of domain lengths | 9.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.52 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF16068- CL0342 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4P009 | 2-91 | NIIRSVLILLAVAVISGCATSPKPLYSWNEYQPVVYEYYALDMGPQEQIETLKKDIEKARAQALPVPPGLHAHLGMLYIDTGHPELA… |
| A0A2J4VFB4 | 5-120 | NIIRSVFILLAVAVISGCATSPKPLYSWNEYQPVVYEYYALDMGPQEQIEALKKDIEKTRAQALPVPPGLHAHLGMLYIDTGHPELA… |
| A0A439F410 | 2-109 | None |
| A0A7W9WQJ2 | 123-243 | None |
| A0A560F746 | 5-115 | None |
| F4HEQ2 | 1-108 | None |
| A0A811H330 | 19-143 | None |
| A0A2N1ZMN8 | 6-113 | None |
| A0A418RSD9 | 20-145 | None |
| A0A1V1PF00 | 5-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.