DPCstruct | MC15871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Standard deviation of domain lengths | 9.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 23.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5JJU2 | 49-154 | FIKMISIDLPQIMEKKINALVEGGYYPNINELIKDAFKSLLESKADLKISTALEIYKKGDVTLGRASEIAGLSIWEFKEILKSRGVK… |
| A0A0F9NVG8 | 2-84 | VEEIENIAEIEKLDKSSVVRRLLNKAIPSWKLEYAIKLYQNKEISLGKAVELSSLSVWELLEHLTQKKIPLNYDIEDLRYDLE |
| A0A133V4P9 | 3-93 | None |
| A0A497AWF8 | 9-120 | None |
| A0A842XQ36 | 1-71 | None |
| A0A133VGD6 | 28-114 | None |
| A0A7Y8IYG2 | 1-92 | None |
| A0A3R9RPT1 | 1-84 | None |
| A0A6B0SDY1 | 1-109 | None |
| A0A495ZFL2 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.