DPCstruct | MC15870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 136 ± 22 aa |
| Standard deviation of domain lengths | 22.24 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 31.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13430 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2QWP8 | 25-172 | FYQRKGAKRKRPIPKFLSKHDQKVLKQVRNKAYCLDLVFNLCGFRFGWSAIVQLIPVIGDVISLMLGLRLIRAAQKIEGGLPQVLVS… |
| C5MC05 | 55-198 | EYVPIGTKSNGEQIVKKITRRIPDGISANDLDVLQSFKKRAYRYDYWFKILGVNFGWTNIVSVIPVVGTIVATFWSLQLLWLTRKLE… |
| A0A8A7MDM1 | 8-120 | None |
| A0A0W4ZW47 | 24-171 | None |
| A0A661NUL4 | 43-207 | None |
| A0A2S8FSK7 | 69-190 | None |
| A0A0H5D3S1 | 5-119 | None |
| A0A5C5Z5Z8 | 1-145 | None |
| J6ELF3 | 34-165 | None |
| A0A3N4I989 | 51-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.