DPCstruct | MC1587
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 165 ± 21 aa |
| Standard deviation of domain lengths | 21.26 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q8RLC0 | 1-143 | MSQGLHEWQTSSGKLILVVGSYQDVTSFHRSYSFYFKTNGDQDWNQVPLMPKNSGMEFTWESASGGDVLLADGIVVSRQEGTYFVVA… |
| A0A494X8S4 | 2-162 | PRVIPVDNGINQVELHGQPAMVVRAWRENFNAHGFDVISMFVKETSGSGNGSWNIVPIFDREAGNPERLNFVAGGGADCQLRDFRLL… |
| A0A1C3RDW2 | 1-174 | None |
| A0A6L6QDQ3 | 18-163 | None |
| A0A838MJ58 | 80-260 | None |
| A0A149UCW9 | 1-187 | None |
| A0A0S6VVY5 | 2-133 | None |
| A0A1H1ZLM6 | 4-143 | None |
| A0A2M7VGC0 | 113-295 | None |
| A0A7L9RI63 | 17-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.