DPCstruct | MC15868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 110 ± 4 aa |
| Standard deviation of domain lengths | 4.30 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A563E9R5 | 26-138 | PYAWWTLAGAAFGFAVAGILTIGPPILLLALAMVVCGARVRRLRGAESYLILVGISAAPWFLAWLNRDGPGTVCRVAGTTTACVQEW… |
| A0A537TXD0 | 1-107 | MVGAALGLGIPSLGPLLTLPVVVIALLLARRPSIRRWAFGLATGVGSVLLLVAYVQRQGPGTTCWRTATATGCDQHLDPRPWLAFGI… |
| A0A6H1K9X9 | 8-119 | None |
| A0A841BNS0 | 2-109 | None |
| A0A4R7GQ70 | 41-155 | None |
| A0A5Q0NUD5 | 253-368 | None |
| A0A510V5X8 | 17-121 | None |
| A0A4R7MBB4 | 48-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.