DPCstruct | MC15864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Standard deviation of domain lengths | 11.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19643 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3D575 | 139-226 | EYDLVVMDPGFDYWMNTNPIRIDHYSNEYLQSVNARYVQEWNRRYMLGDKDVNSYIEYESSKQYNKDFNFKLFMYFKYFEETTGKKLF |
| A0A5J4J0G7 | 3-113 | GGTKDANNVITDTITIANESLDYEIIILEQGFERYLSTQPNEEYYSETFLESKNLFYSQEYNRRVRDISRSRDLYPQEINYDRNVHY… |
| A0A1M3L9U0 | 61-159 | None |
| A0A7Y3AUP5 | 13-121 | None |
| A0A840CYA4 | 123-238 | None |
| F5J2Q9 | 131-222 | None |
| A0A4Q8RVU9 | 15-132 | None |
| A0A7J5UX38 | 18-128 | None |
| A0A1Q3RU22 | 21-142 | None |
| A0A838ZS53 | 205-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.