DPCstruct | MC15861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 259 ± 25 aa |
| Standard deviation of domain lengths | 24.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 22.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K1Q1J2 | 1-251 | MVERVPTIDEIDSGNKLAAYLSKRSPHEAQLIALRSSLRVMPLLARILSLNKVSRSLKSRLTVSIFRRNLISWAIHSFPNYEMGNAA… |
| Q89RQ9 | 6-248 | SVQDFASTEDVNRWLAGQSPEQTVVFVARAALRVIPAFNLSYGDNFSRALQMFRCADSTWAVAAYPGYRDRLISAALNTLDSVEPRP… |
| A0A1G5QQM1 | 7-258 | None |
| A0A7C5SEH1 | 5-260 | None |
| A0A832IYY5 | 1-246 | None |
| A0A450XT86 | 15-242 | None |
| A0A285M2Z9 | 8-255 | None |
| A0A6B8KE76 | 99-382 | None |
| A0A1H4EUP8 | 1-323 | None |
| A0A7W6GNI7 | 7-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.