DPCstruct | MC15860
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 91 ± 10 aa |
| Standard deviation of domain lengths | 10.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 44.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F3GJW1 | 1-86 | MLGHSIGAALVGTFLGVLLCYGFVGPIANVLELKAKEEEVYFHVIRVALVAFVGGAAPQMAVESGRRAIPSSERPSFTELEESIRK |
| A0A832LS50 | 107-201 | TMGKIDQPPEVIGHSVAAALVGTFLGVLLSYGFVGPLARNLENAARAEHHILVCIKAAVLAFARGVPSVVAIEYGRRAIEPHERPSF… |
| X7EC41 | 18-105 | None |
| A0A7Y2KXW9 | 2-74 | None |
| A0A655D6Y4 | 101-202 | None |
| A0A7W1N9X0 | 46-128 | None |
| A0A089NVL3 | 98-179 | None |
| A0A4U9HZ14 | 101-204 | None |
| A0A2X2XUR1 | 113-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.