DPCstruct | MC1586
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 85 ± 11 aa |
| Standard deviation of domain lengths | 11.07 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A494X8K6 | 3-80 | KSNCRVCGYELASPPWGDDGDSPSWDICPCCGTEFGYEDCTLVSTKRKRDQWIAEGCKWFEPKKRPLDWDCERQCENI |
| B7KK54 | 2-77 | YKCPVCGYKGLEAPPYESGSPSFEICPSCGTEFGYDDAETDHATLRHVWIEAGAKWWSSSTCPPPGWNPYEQLREA |
| A0A2M8WRZ4 | 7-86 | None |
| E8NEB0 | 4-89 | None |
| A0A432ZF28 | 100-180 | None |
| L0DGS0 | 24-134 | None |
| T0FPK0 | 64-149 | None |
| B4D0B6 | 2-85 | None |
| A0A368VME6 | 3-83 | None |
| A0A561PVN7 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.