DPCstruct | MC15859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 158 ± 23 aa |
| Standard deviation of domain lengths | 22.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 20.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09832 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850M3W3 | 7-117 | KSKQDDIKKLIELSGAKNIATQSFNFIMQTYKEQDPEIYEILEKEINLEEMIDEIFTHIYNRYFTESEIEGLIRFYESSLGKKMLSL… |
| A0A2V7VUU4 | 5-163 | LVVVAALAVSLPLFATEPNPSARQRELVLKLLDQMNMGQTIAKLTDAIFAQMEKQFLDAADASGGKPEATAEAKEAYAAFRQKAAKI… |
| A0A4R5W125 | 14-181 | None |
| A0A1W1EEG5 | 3-139 | None |
| A0A656H0B2 | 1-148 | None |
| A0A318BBG6 | 1-192 | None |
| A0A1Y6CFM5 | 68-247 | None |
| A0A6G6RJ51 | 8-158 | None |
| A0A2N6FE74 | 2-142 | None |
| A0A6J4MU15 | 9-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.