DPCstruct | MC15858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 279 ± 28 aa |
| Standard deviation of domain lengths | 28.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212DSV3 | 2-253 | QGFRFTADQSAGGEDAKAVRTAAQKALATEFEARAERFGACANGDIALGSDGTLRWIGAPVGTLVAGDEPLKPRLVLLADEQLTGPA… |
| A0A2V7VKP4 | 54-296 | EGFRFVPDRAVREGSKGLLAAANRALRAGIRERVATLAADGDAAFALRAPDDVVWRGAPVARLVAGESVLAPQIEVLPSELLDPPLR… |
| A0A845RWR7 | 8-297 | None |
| A0A7V4P8A0 | 114-458 | None |
| A0A2D7PBL4 | 149-408 | None |
| A0A4Q4CMU7 | 4-302 | None |
| A0A285JFD4 | 163-421 | None |
| A0A366EJ10 | 39-316 | None |
| A0A2M8CWF5 | 3-242 | None |
| E6YNF7 | 18-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.