DPCstruct | MC15857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 77 ± 11 aa |
| Standard deviation of domain lengths | 11.46 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 94.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388QU77 | 21-91 | GHGGMDHVMNYRMLDCLRQGITPDMTVYDAADWSSILEISVRSVKDGSMPIQCPDFTRGGWQGIKPLGIVS |
| A0A2V7VHC7 | 6-71 | RGHGGMDFLEDWRLIECLRRGLPTDQNVYDAAAWSAIAGLTERSVAEGSRPVEVPDFTRGRWKTTP |
| A0A645HB27 | 23-102 | None |
| W4PES8 | 1-57 | None |
| A0A355KWY2 | 114-193 | None |
| A0A7X6U5W3 | 78-156 | None |
| A0A6C0NG30 | 175-262 | None |
| A0A7W1DV52 | 108-200 | None |
| R6XUM6 | 66-153 | None |
| A0A7Y5W631 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.