DPCstruct | MC15856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 169 ± 28 aa |
| Standard deviation of domain lengths | 27.67 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.15 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | PF07583- PF07587 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3C555 | 259-428 | GDQDTLRKTYVLNRGVYDAHGEVVQASTPKSVLGFSEKYPKNRLGLTQWLFDKQNPLTSRVFVNQVWQEYFGRGLVKTSGDFGMQGE… |
| A0A2V7VGF2 | 7-175 | ASASMRKAIAELAIPTAMTLRERPAGERPSTSLRVRGAFTSPGERVYAAVPPALHPLPENAMPNRLGLALWLVDENNPLTPRVTVNR… |
| A0A432FDX1 | 17-154 | None |
| A0A2E9RTW7 | 735-908 | None |
| A0A7Y5VQF1 | 12-152 | None |
| A0A517ZYA5 | 384-555 | None |
| A0A5C6D9W1 | 130-286 | None |
| A0A7D8YCL1 | 683-858 | None |
| A0A2A2Y8P6 | 131-291 | None |
| A0A7Y5MFC1 | 63-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.