DPCstruct | MC15853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 7.73 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0QX47 | 719-787 | ASEVTEKLNLVPKTIELKEDNAKAVYSMKINEQRKLFGFILLNSQRTITADAENGNILTDRHSWYRFLT |
| A0A554J1J8 | 1-88 | MTIGVASQKALEAAKLDSIQEAKQKEVDGKPAYEVTGTAKGRFLFVIPMSFSVKTIIDAKTGSIEQIERSWWNFLVRAYPRSKNLSPI |
| A0A7J4NTC1 | 52-137 | None |
| A0A7C5RD80 | 584-656 | None |
| A0A497SEV7 | 75-150 | None |
| A0A5E4K0T5 | 109-196 | None |
| A0A7C1QFB0 | 410-488 | None |
| A0A0B3B7P3 | 494-572 | None |
| A0A2H9Q141 | 1-85 | None |
| A0A256Y9J4 | 224-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.