DPCstruct | MC15851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 242 ± 48 aa |
| Standard deviation of domain lengths | 48.06 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0292 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1C819 | 38-310 | MKEAALWSVLWFSLSFVFVGLLWWYLNDSQGREVANTVSMQFITGYLVEKSLSIDNIFVFLMIFSYFAVPEQYQKRALIIGIIGAIV… |
| A0A1V6G1Y3 | 4-244 | ESLTALVGLTVMEIVLGIDNVVFLAIVVTRLPAPQQPRARTLGLMLALLTRIGLLFTLSWMMRLTQPFLSVAGIEVTGRGLILVLGG… |
| A0A378A902 | 2-165 | None |
| R1CXK4 | 521-802 | None |
| A0A537T0Y3 | 12-237 | None |
| A0A4R7K4G6 | 7-196 | None |
| A0A7T5JRE9 | 6-209 | None |
| A0A812QXH1 | 396-666 | None |
| A0A7C4LWX0 | 252-465 | None |
| A0A7S3ZKM7 | 8-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.