DPCstruct | MC15850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Standard deviation of domain lengths | 9.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 18.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12164 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z3H8I6 | 24-109 | DPVVVELNPSATVGTNLITVGDVALISGGDAGTRARVAKVDLFELKARSAGTVVGRLSVCYRLELAGFDAGAVRVTGADRVTVTPA |
| A0A1V6G0R6 | 66-164 | ATIIALKPLARVASGYVRVCDIAEFVEDPEGLAPFLGTIVIGPAPEPEKIAVIDRAKTAQRIEEYGLAFDRYLLTGAYQVLVMRVKA… |
| A0A7V5HZF2 | 23-123 | None |
| A0A0N1KG59 | 50-165 | None |
| A0A833HQ87 | 1-105 | None |
| T5LWH8 | 1-98 | None |
| A0A7G9WBZ3 | 3-102 | None |
| A0A7C6YWZ3 | 17-117 | None |
| A0A523ICJ8 | 22-132 | None |
| A0A5S9MAD9 | 2-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.