DPCstruct | MC15848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 309 ± 21 aa |
| Standard deviation of domain lengths | 21.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 25.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521ZTU8 | 8-274 | AYYYPMLVSAVSGRPNTAEELVARWKFFKSLPQIFRDILMSQEVPLAVKYISEQYTLGEARTTELSRIIRGVFFGELTKEQLSQAVA… |
| A0A0G0P1J0 | 39-333 | KELLAKWQKAYAHAQIFPNSVVSMNPALIDFLLSFENTLFYNDLAKKFALNQQQRDDLPQIVWAICKNKNWLELETLLQNTLNIDSS… |
| A0A2J0KQI1 | 16-335 | None |
| A0A7V2V778 | 1-324 | None |
| A0A5C7W9B0 | 1-309 | None |
| K1ZT75 | 1-310 | None |
| A0A2G9Z3L3 | 10-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.