DPCstruct | MC15845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 66 ± 3 aa |
| Standard deviation of domain lengths | 3.32 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 37.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523RN46 | 85-146 | PCELPRESSASFGETLLDFIPPLAKADFKASFEELDLPREIKDAIIVYRGELTKKYEYLNQY |
| A0A7Y2K7Y9 | 106-171 | PCEFSFDASEQFSKDLFPFLEDIVKADYNGTLADSQLPSEIKRAVIMWQGDFTEDFNYMIKFLEAE |
| A0A7S3IKI2 | 54-126 | None |
| A0A0B2V1Y3 | 215-281 | None |
| A0A2M7ZF95 | 1-62 | None |
| A0A0S7G221 | 147-213 | None |
| A0A0S7FUC9 | 147-213 | None |
| A0A7C1BGJ1 | 51-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.