DPCstruct | MC15842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 154 ± 24 aa |
| Standard deviation of domain lengths | 23.93 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662IWG7 | 20-194 | RVHGVLQELLEKQEAELARLSVEELKRLYGEREAKVSLEKFIEQEGRKVIQAKFKDREFFVRFIKDPEEVEERYGDRRYKPMGRAEI… |
| A0A7C5IDR3 | 38-177 | AGMSFQEFARHQSRKVNQGIFKERFYFIRFIKDPEEIDLWYGDRCYHPLGRASITGWILDDQDAIFTPCRYLLSNAESADGSALPNL… |
| A0A7C5VEL8 | 2-136 | None |
| A0A7V8VEV0 | 289-451 | None |
| A0A2G9Z7N8 | 56-220 | None |
| A0A257NG28 | 61-214 | None |
| A0A7C4QS39 | 90-262 | None |
| A0A7C3LT93 | 75-260 | None |
| A0A7J2YL11 | 3-130 | None |
| A0A846PJ25 | 2-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.