DPCstruct | MC15841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 139 |
|---|---|
| Mean domain length (aa) | 114 ± 18 aa |
| Standard deviation of domain lengths | 17.99 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 19.38 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF05635- CL0014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V3D293 | 2-100 | AVEVYQLTEKLPKEEKFGLISQINRSVISIPSNIAEGAGRNTSKEFNNFLGIAQGSSFELDTQLIISNRLNFISNEDYQRLEMQLEH… |
| A0A7C2UC64 | 2-107 | DLVVSSYRLAERLPAREKYGLTSQLQRAAVSIPANIAEGHGRKRTGDYLHQLSIAHGSPMELETHFLIAGRLAYLKTPDIETILRQT… |
| A0A3N9P0G5 | 437-554 | None |
| A0A7C5J2S6 | 3-105 | None |
| A0A2N2WFK5 | 15-129 | None |
| A0A7U4THF5 | 2-84 | None |
| A0A1G1Z020 | 52-163 | None |
| A0A832M5V9 | 1-151 | None |
| A0A3B9PAA8 | 2-91 | None |
| R6H2K5 | 23-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.