DPCstruct | MC15836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 8.50 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 35.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0225 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5CYT8 | 2-92 | NEDTIRRLGLITLFAVLFFHMLFAEGGVIGYLKVKRGIKAANASIITMERENKLLKAEIDRLQNDDQYLEEVVRKKFGFVGEGERLY… |
| A0A1D2SGM9 | 1-96 | MRTLGIVLASLLVLIQYPLWLGKGGWLRVWELDRQLHAQQEVNARLASRNSALQAEVDDLRAGKQALEERARYELGMVMPGEIFVQI… |
| A0A6F8PP02 | 1-101 | None |
| A0A6H9HZ26 | 4-102 | None |
| A0A0F5JXW4 | 1-98 | None |
| A0A351RRU3 | 24-113 | None |
| A0A509C4K3 | 1-90 | None |
| A0A850R9E0 | 1-92 | None |
| A0A7C1WX32 | 1-88 | None |
| A0A357KRN7 | 1-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.