DPCstruct | MC15835
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 115 ± 15 aa |
| Standard deviation of domain lengths | 14.74 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0447 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N7HSM7 | 3-113 | ANILIGLVALLHVYFLILEMFLWSKPFGQKAFNLTPEFAEASKTLAANQGLYNGFLAAGLAWGICLGAAGFSVKLFFLVCVIVAGVY… |
| A0A2D1KZD5 | 3-119 | ILTLFIVALVALEHIGIAGLEMFAKPEVQANAFDMPVEFVKDSHAKVALANQGIYNGLFGVLMLLMILFFTGAVLRTILILMLLYII… |
| G5KGN9 | 14-130 | None |
| A0A6M8W6S6 | 67-182 | None |
| A0A4Y3VZL9 | 1-113 | None |
| A0A543I4K4 | 2-125 | None |
| A0A1S7MYR8 | 110-244 | None |
| A0A2E3ENX7 | 1-94 | None |
| A0A556MYP3 | 5-119 | None |
| A0A0R2CMW1 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.