DPCstruct | MC15833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 164 ± 25 aa |
| Standard deviation of domain lengths | 24.50 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0487- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3QPQ8 | 53-252 | SAHSLLFHRVLFEVHSLKLLAAHCFIQHQHLMPENVVEEKTKAMDLHAVLAELPRPRRPPLQWRYSEVSFMELDKFLEDVRNGIYPL… |
| K7G6G8 | 11-163 | KGLDLNMVMAEIRREGQPAQQWRYSEVCFLELDKFLEDVRNGIYPLMNFAATRPQLLPRALSQPQEDPQKAKTPTPEPFDVETRKVV… |
| A0A0B0N1G9 | 38-164 | None |
| A0A0S7FJL5 | 1-144 | None |
| A0A2J7PPH6 | 107-280 | None |
| A0A834M4L7 | 79-235 | None |
| H0XPC8 | 5-193 | None |
| A0A834TQH5 | 245-367 | None |
| A0A7M5U6Q0 | 29-209 | None |
| A0A7J6YYN0 | 101-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.