DPCstruct | MC15831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 209 ± 29 aa |
| Standard deviation of domain lengths | 28.70 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3NBP0 | 4-206 | LGLQRALDAWNRVVLALPAALLVKVKPDGGGATLEVDALVEHVNRLQRRACSPVGLLSCHLTSHFLRGLLCAGARCGRPGEEVNNAW… |
| K7FXF3 | 44-250 | LLRQQELFTFYFRILLSLPPSVVVMTCRRGKKTTLDCEDFFHFVNTELRNICSRGCTLSYDITAHFFRGLLNASLEHEESAQVVNDV… |
| A0A3P8X7F7 | 554-771 | None |
| A0A6P6DLK3 | 851-1052 | None |
| B7Z6Y4 | 44-254 | None |
| A0A2R2MNP1 | 8-168 | None |
| A0A2R2MK78 | 1-285 | None |
| A0A673UJA7 | 66-279 | None |
| A0A3N0YF00 | 356-542 | None |
| A0A7J7EI77 | 440-622 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.