DPCstruct | MC1583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 213 ± 29 aa |
| Standard deviation of domain lengths | 28.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 25.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06834 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379U4A5 | 1-212 | MNLHRTLLCLLIMMPCAGNVITTPEIAASALSPTCVKYQVVGVCYWLFCTPFGCSVRTSVKVRHFRPDLVVSAYSDTGQNPWAEMSL… |
| A0A1M3JI79 | 1-160 | TVRTSTKVRHYVPDAVVSSYSNTGENPWVEVRAMSTPNPSAQAGGDGTTNEDHENNLAKFKNADVIGHPGVEVFNQFISSSGYFCEG… |
| A0A077ZPJ1 | 3-175 | None |
| A0A173KZS9 | 329-561 | None |
| A0A3A1Y8N7 | 106-352 | None |
| A0A3R0VTR9 | 1-186 | None |
| W0DYF4 | 14-241 | None |
| A0A1C7FK24 | 9-225 | None |
| A0A4Q4XCX1 | 149-351 | None |
| A0A828LPY2 | 1-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.