DPCstruct | MC15827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 127 ± 7 aa |
| Standard deviation of domain lengths | 7.29 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6BX12 | 7-130 | NFDFSDFYDEGFEKTSNICQAIYVFQDGSMWNGYSEGGGGYIRDVDHGSIEAFFKDTSIDRYHPEYHSMVLSELVQVVPETQTVLTL… |
| A0A4Y9K8W5 | 1-109 | MDNKTIVEILNEYDVETTNNIDEAIYILTDGQLISGMFDYGSRTQDHRCIEVLFDDTDRYDNQFWNKLVERTGIVQYVPETQMILLK… |
| D7V1H0 | 6-138 | None |
| A0A0C1LX65 | 4-136 | None |
| A0A139NH06 | 353-477 | None |
| A0A6I4XVA8 | 7-131 | None |
| A0A7X0WME6 | 148-265 | None |
| A0A0R2FD52 | 5-128 | None |
| A0A0R2KD61 | 19-145 | None |
| A0A7X0XM59 | 7-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.