DPCstruct | MC15826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 157 ± 8 aa |
| Standard deviation of domain lengths | 8.49 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8M6P9 | 28-176 | WLQTVIEQASIDEVPGCDCCRYTFRKIALLIIAGRITAKELIARDGHDLWDDLTQKHGMKGSARHGGSWHKKMMDVITEYFENQGFE… |
| A0A7X0HYL2 | 20-189 | KNLYNDNRGAVFKEEYKSLIREAISKEIITVVKFIVAENVRGELEQICEAKGLERILIERLKNYHNEPEYRIASLIYILKKIDHDFK… |
| A0A2D6P4U4 | 6-158 | None |
| A0A0G1ZLN5 | 24-177 | None |
| A0A0G1Z178 | 21-175 | None |
| A0A7C1D961 | 5-153 | None |
| K2DEE9 | 3-164 | None |
| A0A6I4VV18 | 49-195 | None |
| A0A0M4G410 | 4-176 | None |
| A0A564G3Z6 | 56-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.