DPCstruct | MC15822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 344 |
|---|---|
| Mean domain length (aa) | 305 ± 89 aa |
| Standard deviation of domain lengths | 88.53 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 80.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 18.52 |
| Pfam Score | 82.24 |
| Assigned Pfam label(s) | CL0063- CL0257- CL0129- CL0442- CL0588 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S8L876 | 32-319 | LFFNSSALDIKPLKNAEIDKNVYLYPGTDGSGRDRRKSREMIKDNANAIGTLLKKYPQTEVMVIFASFAGGTGSGAIKTFIQIAASA… |
| A0A1D2RC48 | 45-376 | VSEEGKLVAGFEGMVVGGFGGDPDKVEKVVSEHYNNFKNLLSKRIRKGSHADIRAKRERIASFAFLSVGLGGGTGSCIAPYVAQAIK… |
| A0A7R8X2X5 | 45-451 | None |
| A0A178EKC6 | 445-833 | None |
| A0A843M9L8 | 34-408 | None |
| V5A299 | 2-199 | None |
| A0A1S8W3N3 | 2-238 | None |
| A0A3S7X6J0 | 4-200 | None |
| A0A0E0I012 | 272-664 | None |
| A0A6A0JSF1 | 65-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.