DPCstruct | MC1582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 4.83 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 48.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8SKP6 | 423-501 | RRGQLGFSLSIDKSLLLLLTDLAVGSNNKILLKELWDEFELRGLRFDQESKAEIIKLYEEINLIEKKSDSGDAQYIQKL |
| A0A379U488 | 1-71 | MLNQDRLLLLTNLTVGKNKKLRLHELLRGFEQRGFYLDNQSTQMLVAFYERMGNVERMSDSGDAVYVRETV |
| R6KNG8 | 1-82 | None |
| A0A377DYB0 | 95-175 | None |
| A0A3S4FWD6 | 261-341 | None |
| A0A7Y0N7K6 | 232-309 | None |
| A0A7H4MCC6 | 36-116 | None |
| A0A080KNQ6 | 179-245 | None |
| A0A2T4RPP4 | 68-147 | None |
| A0A829THL5 | 123-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.