DPCstruct | MC15816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 171 ± 19 aa |
| Standard deviation of domain lengths | 19.04 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 21.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1D787 | 263-435 | MKLYRLKIPEIAHDVIERLCAEGTIEVSNENRAEAELDLVAIMEEYSRRDHELRERVKEYMARNSVPYDRYGKVRGQLSAEMGHPTG… |
| A0A1F9KBP2 | 1-168 | MKIYRKVIPKIAKDVVRSLLANRAIEVEDGHRDEAELDVAGVLVGYLNDLDRIATDAKETMVRHNLPVEMTPRIKKTIADTRKIIVG… |
| A0A7V4YQ88 | 17-180 | None |
| A0A1Y0HQ11 | 1-182 | None |
| Q7MQS4 | 52-231 | None |
| K7T3P7 | 1-162 | None |
| A0A831ZK25 | 58-224 | None |
| A0A2D5QNL1 | 3-202 | None |
| A0A7C2I7H0 | 1-188 | None |
| A0A3D2CCC1 | 76-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.