DPCstruct | MC15813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 215 ± 22 aa |
| Standard deviation of domain lengths | 22.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6R3P8 | 14-229 | KAGLSSVNTECQLKAEKLRAAYKTAKYLADDARRKEEACDALLRDLEDTNKTPDMTIASLKPAFVDHTVGPDSGFTDNTSDHILPFQ… |
| A0A6A6QY74 | 1-206 | MSEIVSPEALRRQIEAHEASHSSLFQRRQAAMHTFDELNEQLAESDRIRKELYRQLRIANQPIPAVHTTNLPPAANQQPHSSAVLAV… |
| A0A6A6YBW5 | 118-346 | None |
| A0A6A6YA44 | 2-199 | None |
| A0A6A6YM49 | 97-315 | None |
| A0A2S6CAY4 | 14-256 | None |
| A0A517L1G9 | 133-342 | None |
| M2LGJ8 | 5-265 | None |
| A0A139H340 | 1-184 | None |
| A0A2S6C4M2 | 173-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.