DPCstruct | MC15811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 8.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 36.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B8QE90 | 13-88 | MMKGWPEKIEAAQLQPTVMVAGRERQRVRYGQEARDWGADRQPCHDCGVLKGQPHVAGCDVERCPACGGQMISCDC |
| A0A1Q7ISX9 | 13-100 | MAVCEDCEQEMLRAQTCKARSLMSFRDETFKPIAYGSETIWPMGFTGACGDCGVAPGGTHHFGCDIEQCPRCGDQLISCDCAEEFDLH |
| A0A382DBM1 | 208-305 | None |
| A0A0F9UQ16 | 1-72 | None |
| A0A0F9NXL8 | 1-80 | None |
| A0A523DAP3 | 122-208 | None |
| A0A6I2R238 | 13-93 | None |
| A0A7Y6NQT9 | 13-91 | None |
| C5ETB4 | 2-88 | None |
| A0A1G9V4P1 | 6-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.