DPCstruct | MC1581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 185 ± 11 aa |
| Standard deviation of domain lengths | 11.18 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G0XBW4 | 163-341 | QPKVLGTDELKKNIDHLYKSLDKKTESTVCHSVALRVAQADKKITEKTFQTLLSQTSNPVKPLYYRLMGVSPDTLKNTLNAADITES… |
| A0A379U157 | 4-182 | PPAITALTTEQLLIKIDNVRLEERPAIPVCYRLAVNAGVVAGTISKETEDILSSIPGNYSENYQKIMGITVGNYFMHISKDHIVDSG… |
| A0A105T3F8 | 421-598 | None |
| A0A2G8E2K0 | 248-440 | None |
| A0A5E6Y163 | 75-263 | None |
| F5P189 | 3-163 | None |
| G8PNU1 | 209-392 | None |
| A0A3S5DG34 | 3-194 | None |
| A0A6L8LSR1 | 974-1151 | None |
| A0A0D8D925 | 19-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.