DPCstruct | MC15809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 344 ± 28 aa |
| Standard deviation of domain lengths | 27.93 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0XPD3 | 70-433 | MPAAAPLFSLTAQPATHRPTDHHLRAILANPLFSYDQTVRSEVRQGTERDPMDIFDWAVARGLMTPKRAAGCLLAKRREAVLSSSVS… |
| A0A2G5HYV5 | 7-331 | SRRKAGDSSFEYAFQRREKEERETAALPLILPDQFALLSKQGQATPEHARSCVYHLKNDLQIKPLSQRGSDSEAGHVGGRVLHWLWG… |
| A0A2G7FKL4 | 2-304 | None |
| A0A0D2GY05 | 53-417 | None |
| A0A2T3AD00 | 77-405 | None |
| A0A139GZG1 | 275-651 | None |
| A0A6A6JUL7 | 66-421 | None |
| A0A1J9PH80 | 2-372 | None |
| A0A4T0AKT6 | 1-285 | None |
| A0A2G5HY13 | 45-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.