DPCstruct | MC15805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 109 ± 13 aa |
| Standard deviation of domain lengths | 13.19 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S5MSD4 | 1-109 | MVVVTHTSCHAPKTTRRYFSCPQSCAAYVPMKVRFMFPVRKPTMPAPLPEPVIPLEQRKSIETLMAHDCRWPIGDPQNADFHFCGKQ… |
| A0A2P6G853 | 19-133 | QSAKRKGKKRGRKPSIKKLINNENTSDSISKINDNFLSESGELESEVDQVTLANMIKIEKKAKKLSLLELTEKTCKWPIGDPATSEF… |
| A0A651G1H7 | 70-191 | None |
| J9A0T5 | 1-112 | None |
| A0A1F3B780 | 45-125 | None |
| A0A0P7X3P1 | 93-226 | None |
| A0A2A4VB32 | 56-161 | None |
| A0A522CDH6 | 60-163 | None |
| B3Q8P5 | 79-186 | None |
| A0A258KXT4 | 62-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.