DPCstruct | MC158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 6.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08520 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177VB29 | 35-105 | MLSRIFHYSVDAVLLSTVLAGVKRTSGLAPDLTQIPEGTPRDLTGKFLGFGEFTFDSLMAAAHASRYFVKP |
| A0A2H5TGT7 | 36-105 | LGKIVHFAADAVLVSAVLAGIKRSTGLSVATHKIENQEIKSAVVKFLNVGEWVVDQSILIISNSSYFERK |
| A0A1E3PDY9 | 3-76 | None |
| A0A409XJT2 | 316-388 | None |
| M5G1F0 | 5-90 | None |
| A0A066WNZ4 | 1-75 | None |
| A0A0F7RS27 | 59-130 | None |
| A0A177VWC5 | 1-75 | None |
| A0A316YYY7 | 2-85 | None |
| A0A2X0M9F6 | 5-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.