DPCstruct | MC15796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 99 ± 7 aa |
| Standard deviation of domain lengths | 7.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A358QXC4 | 1-91 | MSKFLDLLRSGEDIDCDLIIGGVDMPASFVWNGDSKITDYGVEKYKAIMESKYTKLPNGNIEIHCDDDKLGESFCWAAAGHIGTSEY… |
| A0A4Y9IXX7 | 3-101 | ITLKDLLHAINILGDDRDVTVDGMDSIAVCPPVKITPEGEKHFHKALEATVEVEYKNDCHYSTYVSDDEEDINEEAWDLLVSLAGCC… |
| A0A4D7AQU0 | 386-481 | None |
| A0A3N9TML6 | 3-96 | None |
| A0A0F0CBM0 | 112-219 | None |
| A0A3A9FY79 | 11-125 | None |
| A0A1C6H068 | 210-318 | None |
| A0A1Q6L2G9 | 80-175 | None |
| A0A316QSI0 | 195-290 | None |
| A0A7U9S739 | 179-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.